IL3 (Human) Recombinant Protein View larger

IL3 (Human) Recombinant Protein

New product

439,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL3 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsFunc,SDS-PAGE

More info about IL3 (Human) Recombinant Protein

Brand: Abnova
Reference: P3461
Product name: IL3 (Human) Recombinant Protein
Product description: Human IL3 (AAC08706, 20 aa. - 152 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Gene id: 3562
Gene name: IL3
Gene alias: IL-3|MCGF|MGC79398|MGC79399|MULTI-CSF
Gene description: interleukin 3 (colony-stimulating factor, multiple)
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Protein accession: AAC08706
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris, 0.2 mM PMSF, pH 8.0 (10% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3461-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: Func,SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy IL3 (Human) Recombinant Protein now

Add to cart