Brand: | Abnova |
Reference: | P3456 |
Product name: | FGF1 (Human) Recombinant Protein |
Product description: | Human FGF1 (NP_000791, 16 a.a. - 155 a.a.) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 2246 |
Gene name: | FGF1 |
Gene alias: | AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-alpha|FGFA|GLIO703|HBGF1 |
Gene description: | fibroblast growth factor 1 (acidic) |
Immunogen sequence/protein sequence: | MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Protein accession: | NP_000791 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris, 100 mM NaCl, pH 7.0 |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: |  |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |