SNTN (Human) Recombinant Protein View larger

SNTN (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNTN (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about SNTN (Human) Recombinant Protein

Brand: Abnova
Reference: P3436
Product name: SNTN (Human) Recombinant Protein
Product description: Human SNTN (NP_001074006, 1 a.a. - 147 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 132203
Gene name: S100A1L
Gene alias: FLJ44379|sentan
Gene description: Protein S100-A1-like
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMGGCMHSTQDKSLHLEGDPNPSAAPTSTCAPRKMPKRISISKQLASVKALRKCSDLEKAIATTALIFRNSSDSDGKLEKAIAKDLLQTQFRNFAEGQETKPKYREILSELDEHTENKLDFEDFMILLLSITVMSDLLQNIRNVKIMK
Protein accession: NP_001074006
Form: Liquid
Concentration: 0.5 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, 0.15M NaCl, pH 8.0 (1 mM dithiothreitol, 50% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3436-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy SNTN (Human) Recombinant Protein now

Add to cart