MAP1LC3B2 (Human) Recombinant Protein View larger

MAP1LC3B2 (Human) Recombinant Protein

New product

359,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP1LC3B2 (Human) Recombinant Protein

BrandAbnova
Product typeProteins
Host speciesEscherichia coli
ApplicationsSDS-PAGE

More info about MAP1LC3B2 (Human) Recombinant Protein

Brand: Abnova
Reference: P3434
Product name: MAP1LC3B2 (Human) Recombinant Protein
Product description: Human MAP1LC3B2 (NP_001078950, 1 a.a. - 120 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Gene id: 643246
Gene name: MAP1LC3B2
Gene alias: -
Gene description: microtubule-associated protein 1 light chain 3 beta 2
Immunogen sequence/protein sequence: MGSSHHHHHHSSGLVPRGSHMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG
Protein accession: NP_001078950
Form: Liquid
Concentration: 1 mg/mL
Preparation method: Escherichia coli expression system
Storage buffer: In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol)
Storage instruction: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
Aliquot to avoid repeated freezing and thawing.
Quality control testing: Loading 3 ug protein in 15% SDS-PAGE
Quality control testing picture: qc_test-P3434-1.jpg
Tag: His
Product type: Proteins
Host species: Escherichia coli
Antigen species / target species: Human
Applications: SDS-PAGE
Shipping condition: Dry Ice

Reviews

Buy MAP1LC3B2 (Human) Recombinant Protein now

Add to cart