Brand: | Abnova |
Reference: | P3398 |
Product name: | BMP4 (Human) Recombinant Protein |
Product description: | Human BMP4 (NP_001193, 293 a.a. - 408 a.a.) partial recombinant protein expressed in Escherichia coli. |
Gene id: | 652 |
Gene name: | BMP4 |
Gene alias: | BMP2B|BMP2B1|MCOPS6|ZYME |
Gene description: | bone morphogenetic protein 4 |
Immunogen sequence/protein sequence: | MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Protein accession: | NP_001193 |
Form: | Liquid |
Concentration: | 0.5 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 10 mM Sodium citrate buffer, pH 3.5 (10% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: |  |
Tag: | None |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |