CD86 monoclonal antibody (M08), clone 2E6 View larger

CD86 monoclonal antibody (M08), clone 2E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CD86 monoclonal antibody (M08), clone 2E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CD86 monoclonal antibody (M08), clone 2E6

Brand: Abnova
Reference: MAB5000-M08
Product name: CD86 monoclonal antibody (M08), clone 2E6
Product description: Mouse monoclonal antibody raised against a partial recombinant CD86.
Clone: 2E6
Isotype: IgG1 Kappa
Gene id: 942
Gene name: CD86
Gene alias: B7-2|B70|CD28LG2|LAB72|MGC34413
Gene description: CD86 molecule
Genbank accession: BC040261.1
Immunogen: CD86 (AAH40261.1, 24 a.a. ~ 132 a.a) partial recombinant protein with mouse IgG2a-Fc tag.
Immunogen sequence/protein sequence: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSV
Protein accession: AAH40261.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-MAB5000-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.06 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CD86 monoclonal antibody (M08), clone 2E6 now

Add to cart