Brand: | Abnova |
Reference: | MAB5000-M04 |
Product name: | CD86 monoclonal antibody (M04), clone 3F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CD86. |
Clone: | 3F3 |
Isotype: | IgG1 Kappa |
Gene id: | 942 |
Gene name: | CD86 |
Gene alias: | B7-2|B70|CD28LG2|LAB72|MGC34413 |
Gene description: | CD86 molecule |
Genbank accession: | BC040261.1 |
Immunogen: | CD86 (AAH40261.1, 24 a.a. ~ 132 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
Immunogen sequence/protein sequence: | APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSV |
Protein accession: | AAH40261.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.06 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |