SPPL2A monoclonal antibody (M02), clone 1C7 View larger

SPPL2A monoclonal antibody (M02), clone 1C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPPL2A monoclonal antibody (M02), clone 1C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SPPL2A monoclonal antibody (M02), clone 1C7

Brand: Abnova
Reference: H00084888-M02
Product name: SPPL2A monoclonal antibody (M02), clone 1C7
Product description: Mouse monoclonal antibody raised against a partial recombinant SPPL2A.
Clone: 1C7
Isotype: IgG1 Kappa
Gene id: 84888
Gene name: SPPL2A
Gene alias: IMP3|PSL2
Gene description: signal peptide peptidase-like 2A
Genbank accession: NM_032802.3
Immunogen: SPPL2A (NP_116191.2, 31 a.a. ~ 129 a.a) partial recombinant protein with GST-pstS1 tag.
Immunogen sequence/protein sequence: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSE
Protein accession: NP_116191.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084888-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084888-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged SPPL2A is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SPPL2A monoclonal antibody (M02), clone 1C7 now

Add to cart