Brand: | Abnova |
Reference: | H00084888-M02 |
Product name: | SPPL2A monoclonal antibody (M02), clone 1C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SPPL2A. |
Clone: | 1C7 |
Isotype: | IgG1 Kappa |
Gene id: | 84888 |
Gene name: | SPPL2A |
Gene alias: | IMP3|PSL2 |
Gene description: | signal peptide peptidase-like 2A |
Genbank accession: | NM_032802.3 |
Immunogen: | SPPL2A (NP_116191.2, 31 a.a. ~ 129 a.a) partial recombinant protein with GST-pstS1 tag. |
Immunogen sequence/protein sequence: | HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLEKARIAQKGGAEAMLVVNNSVLFPPSGNRSE |
Protein accession: | NP_116191.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SPPL2A is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |