AIFM2 monoclonal antibody (M13A), clone 2C6 View larger

AIFM2 monoclonal antibody (M13A), clone 2C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AIFM2 monoclonal antibody (M13A), clone 2C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about AIFM2 monoclonal antibody (M13A), clone 2C6

Brand: Abnova
Reference: H00084883-M13A
Product name: AIFM2 monoclonal antibody (M13A), clone 2C6
Product description: Mouse monoclonal antibody raised against a partial recombinant AIFM2.
Clone: 2C6
Isotype: IgG1 Kappa
Gene id: 84883
Gene name: AIFM2
Gene alias: AMID|PRG3|RP11-367H5.2
Gene description: apoptosis-inducing factor, mitochondrion-associated, 2
Genbank accession: BC006121
Immunogen: AIFM2 (AAH06121, 1 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVG
Protein accession: AAH06121
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084883-M13A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (62.92 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084883-M13A-13-15-1.jpg
Application image note: Western Blot analysis of AIFM2 expression in transfected 293T cell line by AMID monoclonal antibody (M13A), clone 2C6.

Lane 1: AIFM2 transfected lysate(40.5 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AIFM2 monoclonal antibody (M13A), clone 2C6 now

Add to cart