AMID monoclonal antibody (M09), clone 3A11 View larger

AMID monoclonal antibody (M09), clone 3A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMID monoclonal antibody (M09), clone 3A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about AMID monoclonal antibody (M09), clone 3A11

Brand: Abnova
Reference: H00084883-M09
Product name: AMID monoclonal antibody (M09), clone 3A11
Product description: Mouse monoclonal antibody raised against a partial recombinant AMID.
Clone: 3A11
Isotype: IgG2a Kappa
Gene id: 84883
Gene name: AIFM2
Gene alias: AMID|PRG3|RP11-367H5.2
Gene description: apoptosis-inducing factor, mitochondrion-associated, 2
Genbank accession: NM_032797
Immunogen: AMID (NP_116186, 188 a.a. ~ 287 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA
Protein accession: NP_116186
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084883-M09-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged AIFM2 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy AMID monoclonal antibody (M09), clone 3A11 now

Add to cart