Brand: | Abnova |
Reference: | H00084883-M09 |
Product name: | AMID monoclonal antibody (M09), clone 3A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AMID. |
Clone: | 3A11 |
Isotype: | IgG2a Kappa |
Gene id: | 84883 |
Gene name: | AIFM2 |
Gene alias: | AMID|PRG3|RP11-367H5.2 |
Gene description: | apoptosis-inducing factor, mitochondrion-associated, 2 |
Genbank accession: | NM_032797 |
Immunogen: | AMID (NP_116186, 188 a.a. ~ 287 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA |
Protein accession: | NP_116186 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged AIFM2 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |