No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr,IP |
Brand: | Abnova |
Reference: | H00084883-D01P |
Product name: | AIFM2 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human AIFM2 protein. |
Gene id: | 84883 |
Gene name: | AIFM2 |
Gene alias: | AMID|PRG3|RP11-367H5.2 |
Gene description: | apoptosis-inducing factor, mitochondrion-associated, 2 |
Genbank accession: | NM_032797 |
Immunogen: | AIFM2 (NP_116186.1, 1 a.a. ~ 373 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP |
Protein accession: | NP_116186.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![]() |
Application image note: | Western Blot analysis of AIFM2 expression in transfected 293T cell line (H00084883-T02) by AIFM2 MaxPab polyclonal antibody. Lane 1: AIFM2 transfected lysate(40.50 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |