AIFM2 MaxPab rabbit polyclonal antibody (D01) View larger

AIFM2 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AIFM2 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr,IP

More info about AIFM2 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00084883-D01
Product name: AIFM2 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human AIFM2 protein.
Gene id: 84883
Gene name: AIFM2
Gene alias: AMID|PRG3|RP11-367H5.2
Gene description: apoptosis-inducing factor, mitochondrion-associated, 2
Genbank accession: NM_032797
Immunogen: AIFM2 (NP_116186.1, 1 a.a. ~ 373 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
Protein accession: NP_116186.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00084883-D01-2-B9-1.jpg
Application image note: AIFM2 MaxPab rabbit polyclonal antibody. Western Blot analysis of AIFM2 expression in mouse lung.
Applications: WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy AIFM2 MaxPab rabbit polyclonal antibody (D01) now

Add to cart