PTPN5 monoclonal antibody (M03), clone 2H5 View larger

PTPN5 monoclonal antibody (M03), clone 2H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPN5 monoclonal antibody (M03), clone 2H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about PTPN5 monoclonal antibody (M03), clone 2H5

Brand: Abnova
Reference: H00084867-M03
Product name: PTPN5 monoclonal antibody (M03), clone 2H5
Product description: Mouse monoclonal antibody raised against a partial recombinant PTPN5.
Clone: 2H5
Isotype: IgG1 Kappa
Gene id: 84867
Gene name: PTPN5
Gene alias: FLJ14427|PTPSTEP|STEP
Gene description: protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Genbank accession: NM_032781
Immunogen: PTPN5 (NP_116170, 388 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEG
Protein accession: NP_116170
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084867-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PTPN5 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy PTPN5 monoclonal antibody (M03), clone 2H5 now

Add to cart