TRIM52 monoclonal antibody (M01), clone 6D5 View larger

TRIM52 monoclonal antibody (M01), clone 6D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM52 monoclonal antibody (M01), clone 6D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about TRIM52 monoclonal antibody (M01), clone 6D5

Brand: Abnova
Reference: H00084851-M01
Product name: TRIM52 monoclonal antibody (M01), clone 6D5
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM52.
Clone: 6D5
Isotype: IgG2a Kappa
Gene id: 84851
Gene name: TRIM52
Gene alias: MGC16175|RNF102
Gene description: tripartite motif-containing 52
Genbank accession: NM_032765
Immunogen: TRIM52 (NP_116154, 201 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LANMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ
Protein accession: NP_116154
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084851-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084851-M01-13-15-1.jpg
Application image note: Western Blot analysis of TRIM52 expression in transfected 293T cell line by TRIM52 monoclonal antibody (M01), clone 6D5.

Lane 1: TRIM52 transfected lysate(34.653 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TRIM52 monoclonal antibody (M01), clone 6D5 now

Add to cart