PHF5A monoclonal antibody (M04), clone 1F7 View larger

PHF5A monoclonal antibody (M04), clone 1F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHF5A monoclonal antibody (M04), clone 1F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about PHF5A monoclonal antibody (M04), clone 1F7

Brand: Abnova
Reference: H00084844-M04
Product name: PHF5A monoclonal antibody (M04), clone 1F7
Product description: Mouse monoclonal antibody raised against a full-length recombinant PHF5A.
Clone: 1F7
Isotype: IgG2a Kappa
Gene id: 84844
Gene name: PHF5A
Gene alias: INI|MGC1346|SF3b14b|bK223H9.2
Gene description: PHD finger protein 5A
Genbank accession: NM_032758
Immunogen: PHF5A (NP_116147, 1 a.a. ~ 110 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
Protein accession: NP_116147
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084844-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084844-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged PHF5A is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PHF5A monoclonal antibody (M04), clone 1F7 now

Add to cart