RAX2 MaxPab mouse polyclonal antibody (B01) View larger

RAX2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAX2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RAX2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00084839-B01
Product name: RAX2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RAX2 protein.
Gene id: 84839
Gene name: RAX2
Gene alias: ARMD6|CORD11|MGC15631|QRX|RAXL1
Gene description: retina and anterior neural fold homeobox 2
Genbank accession: NM_032753.2
Immunogen: RAX2 (NP_116142.1, 1 a.a. ~ 184 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA
Protein accession: NP_116142.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084839-B01-13-15-1.jpg
Application image note: Western Blot analysis of RAX2 expression in transfected 293T cell line (H00084839-T02) by RAX2 MaxPab polyclonal antibody.

Lane 1: RAX2 transfected lysate(20.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAX2 MaxPab mouse polyclonal antibody (B01) now

Add to cart