ZNF496 monoclonal antibody (M08), clone 2B3 View larger

ZNF496 monoclonal antibody (M08), clone 2B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF496 monoclonal antibody (M08), clone 2B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re

More info about ZNF496 monoclonal antibody (M08), clone 2B3

Brand: Abnova
Reference: H00084838-M08
Product name: ZNF496 monoclonal antibody (M08), clone 2B3
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNF496.
Clone: 2B3
Isotype: IgG2a Kappa
Gene id: 84838
Gene name: ZNF496
Gene alias: MGC15548|NIZP1|ZKSCAN17
Gene description: zinc finger protein 496
Genbank accession: NM_032752
Immunogen: ZNF496 (NP_116141, 485 a.a. ~ 585 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKDKARPFQCRYCVKSFTQNYDLLRHERLHMKRRSKQALN
Protein accession: NP_116141
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084838-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00084838-M08-4-8-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ZNF496 on NIH/3T3 cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNF496 monoclonal antibody (M08), clone 2B3 now

Add to cart