PLCD4 monoclonal antibody (M01), clone 4D4 View larger

PLCD4 monoclonal antibody (M01), clone 4D4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLCD4 monoclonal antibody (M01), clone 4D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PLCD4 monoclonal antibody (M01), clone 4D4

Brand: Abnova
Reference: H00084812-M01
Product name: PLCD4 monoclonal antibody (M01), clone 4D4
Product description: Mouse monoclonal antibody raised against a partial recombinant PLCD4.
Clone: 4D4
Isotype: IgG1 Kappa
Gene id: 84812
Gene name: PLCD4
Gene alias: MGC12837
Gene description: phospholipase C, delta 4
Genbank accession: BC006355
Immunogen: PLCD4 (AAH06355, 18 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVT
Protein accession: AAH06355
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084812-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084812-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PLCD4 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PLCD4 monoclonal antibody (M01), clone 4D4 now

Add to cart