Brand: | Abnova |
Reference: | H00084812-M01 |
Product name: | PLCD4 monoclonal antibody (M01), clone 4D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLCD4. |
Clone: | 4D4 |
Isotype: | IgG1 Kappa |
Gene id: | 84812 |
Gene name: | PLCD4 |
Gene alias: | MGC12837 |
Gene description: | phospholipase C, delta 4 |
Genbank accession: | BC006355 |
Immunogen: | PLCD4 (AAH06355, 18 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVT |
Protein accession: | AAH06355 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PLCD4 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |