FUT10 monoclonal antibody (M04), clone 4H3 View larger

FUT10 monoclonal antibody (M04), clone 4H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FUT10 monoclonal antibody (M04), clone 4H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA,WB-Re

More info about FUT10 monoclonal antibody (M04), clone 4H3

Brand: Abnova
Reference: H00084750-M04
Product name: FUT10 monoclonal antibody (M04), clone 4H3
Product description: Mouse monoclonal antibody raised against a full length recombinant FUT10.
Clone: 4H3
Isotype: IgG1 Kappa
Gene id: 84750
Gene name: FUT10
Gene alias: MGC11141
Gene description: fucosyltransferase 10 (alpha (1,3) fucosyltransferase)
Genbank accession: BC004884
Immunogen: FUT10 (AAH04884, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGKQDFRLSPLFAVVFLQS
Protein accession: AAH04884
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084750-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084750-M04-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged FUT10 is approximately 1ng/ml as a capture antibody.
Applications: WB-Ti,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FUT10 monoclonal antibody (M04), clone 4H3 now

Add to cart