FUT10 MaxPab mouse polyclonal antibody (B01) View larger

FUT10 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FUT10 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FUT10 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00084750-B01
Product name: FUT10 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FUT10 protein.
Gene id: 84750
Gene name: FUT10
Gene alias: MGC11141
Gene description: fucosyltransferase 10 (alpha (1,3) fucosyltransferase)
Genbank accession: BC004884
Immunogen: FUT10 (AAH04884, 1 a.a. ~ 92 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGKQDFRLSPLFAVVFLQS
Protein accession: AAH04884
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084750-B01-13-15-1.jpg
Application image note: Western Blot analysis of FUT10 expression in transfected 293T cell line (H00084750-T01) by FUT10 MaxPab polyclonal antibody.

Lane 1: FUT10 transfected lysate(10.12 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FUT10 MaxPab mouse polyclonal antibody (B01) now

Add to cart