CNDP1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

CNDP1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNDP1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about CNDP1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00084735-D01P
Product name: CNDP1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CNDP1 protein.
Gene id: 84735
Gene name: CNDP1
Gene alias: CN1|CPGL2|HsT2308|MGC102737|MGC10825|MGC142072
Gene description: carnosine dipeptidase 1 (metallopeptidase M20 family)
Genbank accession: NM_032649.5
Immunogen: CNDP1 (NP_116038.4, 1 a.a. ~ 507 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH
Protein accession: NP_116038.4
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00084735-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CNDP1 expression in transfected 293T cell line (H00084735-T01) by CNDP1 MaxPab polyclonal antibody.

Lane 1: CNDP1 transfected lysate(56.70 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CNDP1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart