CBX2 monoclonal antibody (M09), clone 1E9 View larger

CBX2 monoclonal antibody (M09), clone 1E9

H00084733-M09_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CBX2 monoclonal antibody (M09), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CBX2 monoclonal antibody (M09), clone 1E9

Brand: Abnova
Reference: H00084733-M09
Product name: CBX2 monoclonal antibody (M09), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant CBX2.
Clone: 1E9
Isotype: IgG2a Kappa
Gene id: 84733
Gene name: CBX2
Gene alias: CDCA6|M33|MGC10561
Gene description: chromobox homolog 2 (Pc class homolog, Drosophila)
Genbank accession: NM_032647
Immunogen: CBX2 (NP_116036, 66 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKVGGCAGYADPTSQHPLGVGGRQREGLGPSGRGWHFCQQSVPLLGKQEPPFFLSLSFCCQGPQPAESSSP
Protein accession: NP_116036
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084733-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084733-M09-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged CBX2 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CBX2 monoclonal antibody (M09), clone 1E9 now

Add to cart