PHACS purified MaxPab mouse polyclonal antibody (B01P) View larger

PHACS purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PHACS purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PHACS purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00084680-B01P
Product name: PHACS purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PHACS protein.
Gene id: 84680
Gene name: ACCS
Gene alias: ACS|PHACS
Gene description: 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)
Genbank accession: BC020197.1
Immunogen: PHACS (AAH20197.1, 1 a.a. ~ 501 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQRDMQRVEPSLLQYADWRGHLFLREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATVLCEAGEAFLIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRPFQLTVEKLEMALREAHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLVQYQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLLKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAGKSQVAEDPRPSQSQEPSDQRR
Protein accession: AAH20197.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084680-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ACCS expression in transfected 293T cell line (H00084680-T01) by ACCS MaxPab polyclonal antibody.

Lane 1: PHACS transfected lysate(55.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PHACS purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart