Brand: | Abnova |
Reference: | H00084557-A01 |
Product name: | MAP1LC3A polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MAP1LC3A. |
Gene id: | 84557 |
Gene name: | MAP1LC3A |
Gene alias: | LC3|LC3A|MAP1ALC3|MAP1BLC3 |
Gene description: | microtubule-associated protein 1 light chain 3 alpha |
Genbank accession: | NM_032514 |
Immunogen: | MAP1LC3A (NP_115903, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQE |
Protein accession: | NP_115903 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |