Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00084525-B01P |
Product name: | HOP purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human HOP protein. |
Gene id: | 84525 |
Gene name: | HOPX |
Gene alias: | Cameo|HOP|LAGY|MGC20820|NECC1|OB1|SMAP31|Toto |
Gene description: | HOP homeobox |
Genbank accession: | BC014225 |
Immunogen: | HOP (AAH14225, 1 a.a. ~ 73 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID |
Protein accession: | AAH14225 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of HOPX expression in transfected 293T cell line (H00084525-T01) by HOPX MaxPab polyclonal antibody. Lane1:HOP transfected lysate(8.14 KDa). Lane 2:Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |