Brand: | Abnova |
Reference: | H00084515-M02 |
Product name: | MCM8 monoclonal antibody (M02), clone 1F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MCM8. |
Clone: | 1F9 |
Isotype: | IgG1 Kappa |
Gene id: | 84515 |
Gene name: | MCM8 |
Gene alias: | C20orf154|MGC119522|MGC119523|MGC12866|MGC4816|REC|dJ967N21.5 |
Gene description: | minichromosome maintenance complex component 8 |
Genbank accession: | BC008830 |
Immunogen: | MCM8 (AAH08830, 646 a.a. ~ 735 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM |
Protein accession: | AAH08830 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MCM8 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |