Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SYVN1 monoclonal antibody (M01A), clone 4H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about SYVN1 monoclonal antibody (M01A), clone 4H4
| Brand: | Abnova |
| Reference: | H00084447-M01A |
| Product name: | SYVN1 monoclonal antibody (M01A), clone 4H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SYVN1. |
| Clone: | 4H4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 84447 |
| Gene name: | SYVN1 |
| Gene alias: | HRD1|KIAA1810|MGC40372 |
| Gene description: | synovial apoptosis inhibitor 1, synoviolin |
| Genbank accession: | NM_032431 |
| Immunogen: | SYVN1 (NP_079434, 238 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRS |
| Protein accession: | NP_079434 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SYVN1 expression in transfected 293T cell line by SYVN1 monoclonal antibody (M01A), clone 4H4. Lane 1: SYVN1 transfected lysate(67.685 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |