MKI67IP purified MaxPab mouse polyclonal antibody (B01P) View larger

MKI67IP purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MKI67IP purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about MKI67IP purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00084365-B01P
Product name: MKI67IP purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MKI67IP protein.
Gene id: 84365
Gene name: MKI67IP
Gene alias: NIFK|Nopp34
Gene description: MKI67 (FHA domain) interacting nucleolar phosphoprotein
Genbank accession: NM_032390.3
Immunogen: MKI67IP (NP_115766.2, 1 a.a. ~ 293 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ
Protein accession: NP_115766.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084365-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MKI67IP expression in transfected 293T cell line (H00084365-T01) by MKI67IP MaxPab polyclonal antibody.

Lane 1: MKI67IP transfected lysate(32.23 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MKI67IP purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart