DYDC2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

DYDC2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DYDC2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about DYDC2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00084332-D01P
Product name: DYDC2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human DYDC2 protein.
Gene id: 84332
Gene name: DYDC2
Gene alias: MGC16186|bA36D19.6
Gene description: DPY30 domain containing 2
Genbank accession: NM_032372.3
Immunogen: DYDC2 (NP_115748.1, 1 a.a. ~ 177 a.a) full-length human protein.
Immunogen sequence/protein sequence: METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF
Protein accession: NP_115748.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00084332-D01P-13-15-1.jpg
Application image note: Western Blot analysis of DYDC2 expression in transfected 293T cell line (H00084332-T01) by DYDC2 MaxPab polyclonal antibody.

Lane 1: DYDC2 transfected lysate(20.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DYDC2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart