MGC10540 monoclonal antibody (M01), clone 2E5-2B9 View larger

MGC10540 monoclonal antibody (M01), clone 2E5-2B9

H00084313-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC10540 monoclonal antibody (M01), clone 2E5-2B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about MGC10540 monoclonal antibody (M01), clone 2E5-2B9

Brand: Abnova
Reference: H00084313-M01
Product name: MGC10540 monoclonal antibody (M01), clone 2E5-2B9
Product description: Mouse monoclonal antibody raised against a full length recombinant MGC10540.
Clone: 2E5-2B9
Isotype: IgG1 kappa
Gene id: 84313
Gene name: VPS25
Gene alias: DERP9|EAP20|FAP20|MGC10540
Gene description: vacuolar protein sorting 25 homolog (S. cerevisiae)
Genbank accession: BC006282
Immunogen: MGC10540 (AAH06282, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Protein accession: AAH06282
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084313-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084313-M01-1-25-1.jpg
Application image note: MGC10540 monoclonal antibody (M01), clone 2E5-2B9 Western Blot analysis of MGC10540 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MGC10540 monoclonal antibody (M01), clone 2E5-2B9 now

Add to cart