Cart 167 Product Products 61 974,43 € (empty)
No products
To be determined Shipping
61 974,43 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 167 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 61 974,43 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 61 974,43 €
Data sheet of PDCD2L purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about PDCD2L purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00084306-D01P |
| Product name: | PDCD2L purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PDCD2L protein. |
| Gene id: | 84306 |
| Gene name: | PDCD2L |
| Gene alias: | MGC13096 |
| Gene description: | programmed cell death 2-like |
| Genbank accession: | NM_032346 |
| Immunogen: | PDCD2L (NP_115722.1, 1 a.a. ~ 358 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK |
| Protein accession: | NP_115722.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PDCD2L expression in transfected 293T cell line (H00084306-T01) by PDCD2L MaxPab polyclonal antibody. Lane 1: PDCD2L transfected lysate(39.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |