MGC13096 polyclonal antibody (A01) View larger

MGC13096 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC13096 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MGC13096 polyclonal antibody (A01)

Brand: Abnova
Reference: H00084306-A01
Product name: MGC13096 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MGC13096.
Gene id: 84306
Gene name: PDCD2L
Gene alias: MGC13096
Gene description: programmed cell death 2-like
Genbank accession: BC006146
Immunogen: MGC13096 (AAH06146, 80 a.a. ~ 179 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: CACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVP
Protein accession: AAH06146
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084306-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MGC13096 polyclonal antibody (A01) now

Add to cart