Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C17orf37 monoclonal antibody (M02), clone 3B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about C17orf37 monoclonal antibody (M02), clone 3B5
| Brand: | Abnova |
| Reference: | H00084299-M02 |
| Product name: | C17orf37 monoclonal antibody (M02), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant C17orf37. |
| Clone: | 3B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 84299 |
| Gene name: | C17orf37 |
| Gene alias: | C35|MGC14832|ORB3|RDX12|XTP4 |
| Gene description: | chromosome 17 open reading frame 37 |
| Genbank accession: | NM_032339.3 |
| Immunogen: | C17orf37 (NP_115715.3, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL |
| Protein accession: | NP_115715.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.8 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C17orf37 expression in transfected 293T cell line by C17orf37 monoclonal antibody (M02), clone 3B5. Lane 1: C17orf37 transfected lysate(12.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1.Rajendiran S, Parwani AV, Hare RJ, Dasgupta S, Roby RK, Vishwanatha JK Mol Cancer. 2014 Nov 19;13(1):250. doi: 10.1186/1476-4598-13-250. |