C17orf37 MaxPab mouse polyclonal antibody (B01) View larger

C17orf37 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C17orf37 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C17orf37 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00084299-B01
Product name: C17orf37 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human C17orf37 protein.
Gene id: 84299
Gene name: C17orf37
Gene alias: C35|MGC14832|ORB3|RDX12|XTP4
Gene description: chromosome 17 open reading frame 37
Genbank accession: NM_032339.3
Immunogen: C17orf37 (NP_115715.3, 1 a.a. ~ 115 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL
Protein accession: NP_115715.3
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084299-B01-13-15-1.jpg
Application image note: Western Blot analysis of C17orf37 expression in transfected 293T cell line (H00084299-T01) by C17orf37 MaxPab polyclonal antibody.

Lane 1: C17orf37 transfected lysate(12.65 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice
Publications: Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells.Dasgupta S, Wasson LM, Rauniyar N, Prokai L, Borejdo J, Vishwanatha JK.
Oncogene. 2009 Aug 13;28(32):2860-72. Epub 2009 Jun 8.

Reviews

Buy C17orf37 MaxPab mouse polyclonal antibody (B01) now

Add to cart