H00084284-B01P_50ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00084284-B01P |
Product name: | C1orf57 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human C1orf57 protein. |
Gene id: | 84284 |
Gene name: | C1orf57 |
Gene alias: | FLJ11383|MGC13186|RP4-678E16.2 |
Gene description: | chromosome 1 open reading frame 57 |
Genbank accession: | NM_032324.1 |
Immunogen: | C1orf57 (NP_115700.1, 1 a.a. ~ 190 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK |
Protein accession: | NP_115700.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of C1orf57 expression in transfected 293T cell line (H00084284-T01) by C1orf57 MaxPab polyclonal antibody. Lane 1: C1orf57 transfected lysate(20.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |