> >>RNF135 purified MaxPab rabbit polyclonal antibody (D01P)
RNF135 purified MaxPab rabbit polyclonal antibody (D01P) View larger

RNF135 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of RNF135 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about RNF135 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00084282-D01P
Product name: RNF135 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RNF135 protein.
Gene id: 84282
Gene name: RNF135
Gene alias: L13|MGC13061|Riplet
Gene description: ring finger protein 135
Genbank accession: NM_197939.1
Immunogen: RNF135 (NP_922921.1, 1 a.a. ~ 210 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT
Protein accession: NP_922921.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00084282-D01P-2-A1-1.jpg
Application image note: RNF135 MaxPab rabbit polyclonal antibody. Western Blot analysis of RNF135 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RNF135 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart