Cart 214 Product Products 69 089,22 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...290,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Bovine...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
1 x Mouse...290,00 € -
1 x Mouse...290,00 € -
1 x Mouse...290,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x AR...259,07 € -
1 x PRIC285...259,07 € -
-
-
-
1 x p21...259,07 € -
1 x SSBP2...259,07 € -
1 x MGST3...259,07 € -
-
-
-
1 x ATR...259,07 € -
1 x Tensin-2...259,07 € -
-
-
1 x DNA pol β...259,07 € -
-
-
1 x CaMKIα...259,07 € -
-
-
1 x p18...259,07 € -
1 x RIAM...259,07 € -
-
-
-
1 x MSK1...259,07 € -
-
-
-
-
1 x SR-7...259,07 € -
-
-
1 x N/H/K-Ras...259,07 € -
-
No products
To be determined Shipping
69 089,22 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 214 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 69 089,22 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 69 089,22 €
Data sheet of C9orf89 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about C9orf89 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00084270-B01P |
| Product name: | C9orf89 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C9orf89 protein. |
| Gene id: | 84270 |
| Gene name: | C9orf89 |
| Gene alias: | BinCARD|MGC110898|MGC11115|bA370F5.1 |
| Gene description: | chromosome 9 open reading frame 89 |
| Genbank accession: | NM_032310.3 |
| Immunogen: | C9orf89 (NP_115686.3, 1 a.a. ~ 183 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL |
| Protein accession: | NP_115686.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C9orf89 expression in transfected 293T cell line (H00084270-T01) by C9orf89 MaxPab polyclonal antibody. Lane 1: C9orf89 transfected lysate(20.13 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |