RKHD3 monoclonal antibody (M05), clone 4C4 View larger

RKHD3 monoclonal antibody (M05), clone 4C4

H00084206-M05_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RKHD3 monoclonal antibody (M05), clone 4C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RKHD3 monoclonal antibody (M05), clone 4C4

Brand: Abnova
Reference: H00084206-M05
Product name: RKHD3 monoclonal antibody (M05), clone 4C4
Product description: Mouse monoclonal antibody raised against a partial recombinant RKHD3.
Clone: 4C4
Isotype: IgG2b Kappa
Gene id: 84206
Gene name: MEX3B
Gene alias: DKFZp434J0617|MEX-3B|MGC117199|RKHD3|RNF195
Gene description: mex-3 homolog B (C. elegans)
Genbank accession: NM_032246
Immunogen: RKHD3 (NP_115622, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPG
Protein accession: NP_115622
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084206-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RKHD3 monoclonal antibody (M05), clone 4C4 now

Add to cart