ASCC2 monoclonal antibody (M07), clone 3B2 View larger

ASCC2 monoclonal antibody (M07), clone 3B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ASCC2 monoclonal antibody (M07), clone 3B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ASCC2 monoclonal antibody (M07), clone 3B2

Brand: Abnova
Reference: H00084164-M07
Product name: ASCC2 monoclonal antibody (M07), clone 3B2
Product description: Mouse monoclonal antibody raised against a partial recombinant ASCC2.
Clone: 3B2
Isotype: IgG1 Kappa
Gene id: 84164
Gene name: ASCC2
Gene alias: ASC1p100
Gene description: activating signal cointegrator 1 complex subunit 2
Genbank accession: NM_032204
Immunogen: ASCC2 (NP_115580, 672 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS
Protein accession: NP_115580
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084164-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084164-M07-1-1-1.jpg
Application image note: ASCC2 monoclonal antibody (M07), clone 3B2. Western Blot analysis of ASCC2 expression in HeLa(Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ASCC2 monoclonal antibody (M07), clone 3B2 now

Add to cart