Brand: | Abnova |
Reference: | H00084164-M01A |
Product name: | ASCC2 monoclonal antibody (M01A), clone 2F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ASCC2. |
Clone: | 2F7 |
Isotype: | IgM Kappa |
Gene id: | 84164 |
Gene name: | ASCC2 |
Gene alias: | ASC1p100 |
Gene description: | activating signal cointegrator 1 complex subunit 2 |
Genbank accession: | NM_032204 |
Immunogen: | ASCC2 (NP_115580, 672 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS |
Protein accession: | NP_115580 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.2 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |