BXDC1 MaxPab mouse polyclonal antibody (B01) View larger

BXDC1 MaxPab mouse polyclonal antibody (B01)

H00084154-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BXDC1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about BXDC1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00084154-B01
Product name: BXDC1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human BXDC1 protein.
Gene id: 84154
Gene name: BXDC1
Gene alias: FLJ21087|RPF2|bA397G5.4
Gene description: brix domain containing 1
Genbank accession: NM_032194
Immunogen: BXDC1 (NP_115570, 1 a.a. ~ 306 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIKKN
Protein accession: NP_115570
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084154-B01-13-15-1.jpg
Application image note: Western Blot analysis of BXDC1 expression in transfected 293T cell line (H00084154-T01) by BXDC1 MaxPab polyclonal antibody.

Lane 1: BXDC1 transfected lysate(33.66 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BXDC1 MaxPab mouse polyclonal antibody (B01) now

Add to cart