Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RNASEH2C monoclonal antibody (M02), clone 5D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about RNASEH2C monoclonal antibody (M02), clone 5D6
| Brand: | Abnova |
| Reference: | H00084153-M02 |
| Product name: | RNASEH2C monoclonal antibody (M02), clone 5D6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant RNASEH2C. |
| Clone: | 5D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 84153 |
| Gene name: | RNASEH2C |
| Gene alias: | AGS3|AYP1|FLJ20974|MGC22934 |
| Gene description: | ribonuclease H2, subunit C |
| Genbank accession: | NM_032193.3 |
| Immunogen: | RNASEH2C (NP_115569.2, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED |
| Protein accession: | NP_115569.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.2 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RNASEH2C expression in transfected 293T cell line by RNASEH2C monoclonal antibody (M02), clone 5D6. Lane 1: RNASEH2C transfected lysate (Predicted MW: 17.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |