PPP1R1B monoclonal antibody (M05), clone 1A3 View larger

PPP1R1B monoclonal antibody (M05), clone 1A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R1B monoclonal antibody (M05), clone 1A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about PPP1R1B monoclonal antibody (M05), clone 1A3

Brand: Abnova
Reference: H00084152-M05
Product name: PPP1R1B monoclonal antibody (M05), clone 1A3
Product description: Mouse monoclonal antibody raised against a full-length recombinant PPP1R1B.
Clone: 1A3
Isotype: IgG1 Kappa
Gene id: 84152
Gene name: PPP1R1B
Gene alias: DARPP-32|DARPP32|FLJ20940
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 1B
Genbank accession: BC001519
Immunogen: PPP1R1B (AAH01519, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
Protein accession: AAH01519
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084152-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (44.22 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084152-M05-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PPP1R1B is 0.03 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PPP1R1B monoclonal antibody (M05), clone 1A3 now

Add to cart