ACAD11 polyclonal antibody (A01) View larger

ACAD11 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACAD11 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ACAD11 polyclonal antibody (A01)

Brand: Abnova
Reference: H00084129-A01
Product name: ACAD11 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ACAD11.
Gene id: 84129
Gene name: ACAD11
Gene alias: FLJ12592|MGC150619
Gene description: acyl-Coenzyme A dehydrogenase family, member 11
Genbank accession: NM_032169
Immunogen: ACAD11 (NP_115545, 678 a.a. ~ 780 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI
Protein accession: NP_115545
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084129-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.44 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084129-A01-1-22-1.jpg
Application image note: ACAD11 polyclonal antibody (A01), Lot # 060123JC01 Western Blot analysis of ACAD11 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ACAD11 polyclonal antibody (A01) now

Add to cart