TKTL2 monoclonal antibody (M01), clone 5E2 View larger

TKTL2 monoclonal antibody (M01), clone 5E2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TKTL2 monoclonal antibody (M01), clone 5E2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TKTL2 monoclonal antibody (M01), clone 5E2

Brand: Abnova
Reference: H00084076-M01
Product name: TKTL2 monoclonal antibody (M01), clone 5E2
Product description: Mouse monoclonal antibody raised against a partial recombinant TKTL2.
Clone: 5E2
Isotype: IgG2a Kappa
Gene id: 84076
Gene name: TKTL2
Gene alias: DKFZp434L1717|FLJ32975
Gene description: transketolase-like 2
Genbank accession: NM_032136
Immunogen: TKTL2 (NP_115512, 59 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YKQTDPEHPDNDRFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERHPTPRLPFVD
Protein accession: NP_115512
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084076-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084076-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged TKTL2 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TKTL2 monoclonal antibody (M01), clone 5E2 now

Add to cart