Brand: | Abnova |
Reference: | H00084076-M01 |
Product name: | TKTL2 monoclonal antibody (M01), clone 5E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TKTL2. |
Clone: | 5E2 |
Isotype: | IgG2a Kappa |
Gene id: | 84076 |
Gene name: | TKTL2 |
Gene alias: | DKFZp434L1717|FLJ32975 |
Gene description: | transketolase-like 2 |
Genbank accession: | NM_032136 |
Immunogen: | TKTL2 (NP_115512, 59 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YKQTDPEHPDNDRFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERHPTPRLPFVD |
Protein accession: | NP_115512 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TKTL2 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |