Brand: | Abnova |
Reference: | H00084063-M01 |
Product name: | KIRREL2 monoclonal antibody (M01), clone 2B9-1D3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant KIRREL2. |
Clone: | 2B9-1D3 |
Isotype: | IgG2a kappa |
Gene id: | 84063 |
Gene name: | KIRREL2 |
Gene alias: | DKFZp564A1164|FILTRIN|MGC15718|NEPH3|NLG1 |
Gene description: | kin of IRRE like 2 (Drosophila) |
Genbank accession: | BC007312 |
Immunogen: | KIRREL2 (AAH07312, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLRMRVPALLVLLFCFRGRAGPSPHLLQQPEDLVVLLGEGGAQASLGRRASASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEEGTLETKDPTNGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV |
Protein accession: | AAH07312 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (49.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | KIRREL2 monoclonal antibody (M01), clone 2B9-1D3 Western Blot analysis of KIRREL2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |