KIRREL2 monoclonal antibody (M01), clone 2B9-1D3 View larger

KIRREL2 monoclonal antibody (M01), clone 2B9-1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIRREL2 monoclonal antibody (M01), clone 2B9-1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about KIRREL2 monoclonal antibody (M01), clone 2B9-1D3

Brand: Abnova
Reference: H00084063-M01
Product name: KIRREL2 monoclonal antibody (M01), clone 2B9-1D3
Product description: Mouse monoclonal antibody raised against a full length recombinant KIRREL2.
Clone: 2B9-1D3
Isotype: IgG2a kappa
Gene id: 84063
Gene name: KIRREL2
Gene alias: DKFZp564A1164|FILTRIN|MGC15718|NEPH3|NLG1
Gene description: kin of IRRE like 2 (Drosophila)
Genbank accession: BC007312
Immunogen: KIRREL2 (AAH07312, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLRMRVPALLVLLFCFRGRAGPSPHLLQQPEDLVVLLGEGGAQASLGRRASASFSEQKNLMRIPGSSDGSSSRGPEEEETGSREDRGPIVHTDHSDLVLEEEGTLETKDPTNGYYKVRGVSVSLSLGEAPGGGLFLPPPSPLGPPGTPTFYDFNPHLGMVPPCRLYRARAGYLTTPHPRAFTSYIKPTSFGPPDLAPGTPPFPYAAFPTPSHPRLQTHV
Protein accession: AAH07312
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084063-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (49.83 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084063-M01-1-25-1.jpg
Application image note: KIRREL2 monoclonal antibody (M01), clone 2B9-1D3 Western Blot analysis of KIRREL2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy KIRREL2 monoclonal antibody (M01), clone 2B9-1D3 now

Add to cart