DTNBP1 monoclonal antibody (M02), clone 1B4 View larger

DTNBP1 monoclonal antibody (M02), clone 1B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DTNBP1 monoclonal antibody (M02), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DTNBP1 monoclonal antibody (M02), clone 1B4

Brand: Abnova
Reference: H00084062-M02
Product name: DTNBP1 monoclonal antibody (M02), clone 1B4
Product description: Mouse monoclonal antibody raised against a partial recombinant DTNBP1.
Clone: 1B4
Isotype: IgG2a Kappa
Gene id: 84062
Gene name: DTNBP1
Gene alias: DBND|DKFZp564K192|FLJ30031|HPS7|MGC20210|My031|SDY
Gene description: dystrobrevin binding protein 1
Genbank accession: BC011912
Immunogen: DTNBP1 (AAH11912.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLVELQEQ
Protein accession: AAH11912.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084062-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084062-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged DTNBP1 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DTNBP1 monoclonal antibody (M02), clone 1B4 now

Add to cart