Brand: | Abnova |
Reference: | H00084062-M02 |
Product name: | DTNBP1 monoclonal antibody (M02), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DTNBP1. |
Clone: | 1B4 |
Isotype: | IgG2a Kappa |
Gene id: | 84062 |
Gene name: | DTNBP1 |
Gene alias: | DBND|DKFZp564K192|FLJ30031|HPS7|MGC20210|My031|SDY |
Gene description: | dystrobrevin binding protein 1 |
Genbank accession: | BC011912 |
Immunogen: | DTNBP1 (AAH11912.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLVELQEQ |
Protein accession: | AAH11912.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DTNBP1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |