Brand: | Abnova |
Reference: | H00084033-M02A |
Product name: | OBSCN monoclonal antibody (M02A), clone 5C20 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant OBSCN. |
Clone: | 5C20 |
Isotype: | IgG2a Kappa |
Gene id: | 84033 |
Gene name: | OBSCN |
Gene alias: | DKFZp666E245|FLJ14124|KIAA1556|KIAA1639|MGC120409|MGC120410|MGC120411|MGC120412|MGC138590|UNC89 |
Gene description: | obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF |
Genbank accession: | XM_290923 |
Immunogen: | OBSCN (XP_290923, 1551 a.a. ~ 1649 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KAGMGPYSSPSEQVLLGGPSHLASEEESQGRSAQPLPSTKTFAFQTQIQRGRFSVVRQCWEKASGRALAAKIIPYHPKDKTAVLREYEALKGLRHPHLA |
Protein accession: | XP_290923 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |