OBSCN monoclonal antibody (M02), clone 5C20 View larger

OBSCN monoclonal antibody (M02), clone 5C20

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OBSCN monoclonal antibody (M02), clone 5C20

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about OBSCN monoclonal antibody (M02), clone 5C20

Brand: Abnova
Reference: H00084033-M02
Product name: OBSCN monoclonal antibody (M02), clone 5C20
Product description: Mouse monoclonal antibody raised against a partial recombinant OBSCN.
Clone: 5C20
Isotype: IgG2a Kappa
Gene id: 84033
Gene name: OBSCN
Gene alias: DKFZp666E245|FLJ14124|KIAA1556|KIAA1639|MGC120409|MGC120410|MGC120411|MGC120412|MGC138590|UNC89
Gene description: obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
Genbank accession: XM_290923
Immunogen: OBSCN (XP_290923, 1551 a.a. ~ 1649 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KAGMGPYSSPSEQVLLGGPSHLASEEESQGRSAQPLPSTKTFAFQTQIQRGRFSVVRQCWEKASGRALAAKIIPYHPKDKTAVLREYEALKGLRHPHLA
Protein accession: XP_290923
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084033-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084033-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged OBSCN is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OBSCN monoclonal antibody (M02), clone 5C20 now

Add to cart