Brand: | Abnova |
Reference: | H00084000-M01 |
Product name: | TMPRSS13 monoclonal antibody (M01), clone 4F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TMPRSS13. |
Clone: | 4F7 |
Isotype: | IgG2a Kappa |
Gene id: | 84000 |
Gene name: | TMPRSS13 |
Gene alias: | MSP|MSPL|MSPS|TMPRSS11 |
Gene description: | transmembrane protease, serine 13 |
Genbank accession: | NM_032046 |
Immunogen: | TMPRSS13 (NP_114435, 182 a.a. ~ 279 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLHRSECPSQRY |
Protein accession: | NP_114435 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |